ABCD_AV304 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q8N3I7 Homo sapiens (Human) UniProt: Q9CZQ9 Mus musculus (Mouse) UniProt: B2RZ48 Rattus norvegicus (Rat) |
| Target name | BBS5, Bardet-Biedl syndrome 5 protein |
| Epitope | Sequence:KQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKP |
| Antibody information | |
| Antibody name | N304B/115 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N304B_115.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |