ABCD_AV313 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q8VCD6 Mus musculus (Mouse) UniProt: Q0VGJ9 Rattus norvegicus (Rat) |
| Target name | Reep2, Receptor expression-enhancing protein 2 |
| Epitope | Sequence:RDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIRDEDALPLQGPDGRLQPGPVGLLDTIEDLGDEPALSLRSSTSQPDPRTETSEDDLGDKAPKRTKPIKKVPRAEPPASKTLKTRPKKKSSGGGDSA |
| Antibody information | |
| Antibody name | N326D/2 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N326D_2.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |