ABCD_AV317 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O94805 Homo sapiens (Human) UniProt: P86173 Rattus norvegicus (Rat) UniProt: Q99MR0 Mus musculus (Mouse) |
| Target name | ACTL6B, ACTL6, BAF53B, Actin-like protein 6B, 53 kDa BRG1-associated factor B, Actin-related protein Baf53b, ArpNalpha, BRG1-associated factor 53B, BAF53B |
| Epitope | Sequence:TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL |
| Antibody information | |
| Antibody name | N332B/15R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N332B_15.pdf Addgene: 177533 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |