| Antigen information |
|---|
| Target type |
Protein
|
|---|
| Target link |
UniProt: Q3I5G5 Mus musculus (Mouse)
|
|---|
| Target name |
Foxi2, Forkhead box protein I2
|
|---|
| Epitope |
Sequence:RGETSEAAVPGASSPEGTALEPRGSTPQDPQTSPSPSEATTTCLSGFSTAMGALAGGFGALPDGLAHDFSLRRPPPTAAAHSPQIPNTAPGFAPGHQTGATGFRMGHLIYSRDGTEV
|
|---|
| Antibody information |
|---|
| Antibody name |
N349/96
|
|---|
| Applications |
Immunohistochemistry, Western blot
|
|---|
| Cross-references |
NeuroMab: N349_96.pdf
|
|---|
| Publications |
PMID: 30667360
|
|---|
| Deposited by |
From UC Davis/NIH NeuroMab Facility
|
|---|
| Would you like to obtain this antibody? |
|---|
It can be produced at the Geneva Antibody facility (for more information, please check here).
|
