ABCD_AV323 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9Z2I7 Rattus norvegicus (Rat) UniProt: Q8BFT9 Mus musculus (Mouse) |
| Target name | Svop, Synaptic vesicle 2-related protein, SV2-related protein |
| Epitope | Sequence:MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK |
| Antibody information | |
| Antibody name | N356/9 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N356_9.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |