ABCD_AV326 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: P70673 Rattus norvegicus (Rat) UniProt: Q61743 Mus musculus (Mouse) |
Target name | Kcnj11, ATP-sensitive inward rectifier potassium channel 11, BIR, Inward rectifier K(+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11 |
Epitope | Sequence:TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS |
Antibody information | |
Antibody name | N363/71R |
Applications | Immunohistochemistry |
Cross-references | NeuroMab: N363_71.pdf Addgene: 177535 |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|