ABCD_AV326 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P70673 Rattus norvegicus (Rat) UniProt: Q61743 Mus musculus (Mouse) |
| Target name | Kcnj11, ATP-sensitive inward rectifier potassium channel 11, BIR, Inward rectifier K(+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11 |
| Epitope | Sequence:TARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS |
| Antibody information | |
| Antibody name | N363/71R |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: N363_71.pdf Addgene: 177535 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |