ABCD_AV329 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63664 Rattus norvegicus (Rat) UniProt: P97794 Mus musculus (Mouse) |
| Target name | Kcnj8, ATP-sensitive inward rectifier potassium channel 8, Inward rectifier K(+) channel Kir6.1, Potassium channel, inwardly rectifying subfamily J member 8, uKATP-1 |
| Epitope | Sequence:TTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVRVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRSNSIRRNNSSLMVPKVQFMTPEGNQCPSES |
| Antibody information | |
| Antibody name | N366/60.1 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N366_60.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |