ABCD_AV330 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63664 UniProt: P97794 |
| Target name | Kcnj8, ATP-sensitive inward rectifier potassium channel 8, Inward rectifier K(+) channel Kir6.1, Potassium channel, inwardly rectifying subfamily J member 8, uKATP-1 |
| Epitope | Sequence:TTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVRVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRSNSIRRNNSSLMVPKVQFMTPEGNQCPSES |
| Antibody information | |
| Antibody name | N366/60.6 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N366_60.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |