Expasy logo

ABCD

ABCD_AV331 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9JLU4 Rattus norvegicus (Rat)
UniProt: Q4ACU6 Mus musculus (Mouse)
UniProt: Q9WV48 Rattus norvegicus (Rat)
UniProt: D3YZU1 Mus musculus (Mouse)
Target name Shank3, Prosap2, SH3 and multiple ankyrin repeat domains protein 3, Shank3, Proline-rich synapse-associated protein 2, ProSAP2, SPANK-2
Shank1, SH3 and multiple ankyrin repeat domains protein 1, GKAP/SAPAP-interacting protein, SPANK-1, Somatostatin receptor-interacting protein, SSTR-interacting protein, SSTRIP
Epitope Sequence:
TREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLRGAKAETPIEEF
TPTPAFPALQYLESVDVEGVAWKAGLRT
Antibody information
Antibody name N367/51
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N367_51.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.