ABCD_AV332 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9JLU4 Rattus norvegicus (Rat) UniProt: Q4ACU6 Mus musculus (Mouse) |
| Target name | Shank3, Prosap2, SH3 and multiple ankyrin repeat domains protein 3, Shank3, Proline-rich synapse-associated protein 2, ProSAP2, SPANK-2 |
| Epitope | Sequence:TREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRT |
| Antibody information | |
| Antibody name | N367/62 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N367_62.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |