Expasy logo

ABCD

ABCD_AV332 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9JLU4 Rattus norvegicus (Rat)
UniProt: Q4ACU6 Mus musculus (Mouse)
Target name Shank3, Prosap2, SH3 and multiple ankyrin repeat domains protein 3, Shank3, Proline-rich synapse-associated protein 2, ProSAP2, SPANK-2
Epitope Sequence:
TREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLRGAKAETPIEEF
TPTPAFPALQYLESVDVEGVAWKAGLRT
Antibody information
Antibody name N367/62
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N367_62.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.