ABCD_AV336 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63959 Mus musculus (Mouse) UniProt: Q01956 Rattus norvegicus (Rat) UniProt: Q14003 Homo sapiens (Human) |
| Target name | Kcnc3, Potassium voltage-gated channel subfamily C member 3, KSHIIID, Voltage-gated potassium channel subunit Kv3.3 |
| Epitope | Sequence:AGGLGIMGLPPLPAPGEPCPLAQEEVIETNRAVDPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLVTDYAPSPDGSIRKGYEK |
| Antibody information | |
| Antibody name | N375/67 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N375_67.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |