ABCD_AV336 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q63959 UniProt: Q01956 Rattus norvegicus (Rat) UniProt: Q14003 |
| Target name | Kcnc3, Potassium voltage-gated channel subfamily C member 3, KSHIIID, Voltage-gated potassium channel subunit Kv3.3 |
| Epitope | Sequence:AGGLGIMGLPPLPAPGEPCPLAQEEVIETNRAVDPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLVTDYAPSPDGSIRKGYEK |
| Antibody information | |
| Antibody name | N375/67 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N375_67.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |