Expasy logo

ABCD

ABCD_AV337 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q60700 Mus musculus (Mouse)
UniProt: Q63796 Rattus norvegicus (Rat)
Target name Map3k12, Zpk, Mitogen-activated protein kinase kinase kinase 12, Dual leucine zipper bearing kinase, DLK, Leucine-zipper protein kinase, ZPK, MAPK-upstream kinase, MUK, Mixed lineage kinase
Epitope Sequence:
GSQHLTPAALLYRAAVTRSQKRGISSEEEEGEVDSEVELPPSQRWPQGPNMRQSLSTFSS
ENPSDVEEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDLPTSEVVPEREA
SSLPMQHQDGQGPNPEDSDCDSTELDNSNSIDALRPPASLPP
Antibody information
Antibody name N377/20R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N377_20.pdf
Addgene: 177538
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).