ABCD_AV345 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9UPV9 Homo sapiens (Human) UniProt: D4ACC5 Rattus norvegicus (Rat) |
| Target name | TRAK1, OIP106, Trafficking kinesin-binding protein 1, 106 kDa O-GlcNAc transferase-interacting protein, Protein Milton |
| Epitope | Sequence:MALVFQFGQPVRAQPLPGLCHGKLIRTNACDVCNSTDLPEVEIISLLEEQLPHYKLRADTIYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYN |
| Antibody information | |
| Antibody name | N389/9 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N389_9.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |