ABCD_AV346 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O60296 Homo sapiens (Human) UniProt: Q8R2H7 Rattus norvegicus (Rat) |
| Target name | TRAK2, ALS2CR3, Trafficking kinesin-binding protein 2, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein |
| Epitope | Sequence:SPISENPLQPLPKSLAIPSTPPNSPSHSPCPSPLPFEPRVHLSENFLASRPAETFLQEMYGLRPSRNPPDVGQLKMNLVDRLKRLGIARVVKNPGAQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAPVCTSSPKMGVLKED |
| Antibody information | |
| Antibody name | N390/43 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N390_43.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |