| Antigen information |
|---|
| Target type |
Protein
|
|---|
| Target link |
UniProt: Q9JIH7 Rattus norvegicus (Rat)
|
|---|
| Target name |
Wnk1, Hsn2, Prkwnk1, Serine/threonine-protein kinase WNK1, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1
|
|---|
| Epitope |
Sequence:MSDGTAEKQSGTPGFLSPPAPVPKNGSSSDSSVGEKLGAAVADSGIGRTEEYRRRRHTMDKDSRGAAATTTPTEHRFFRRSVICDSNATALELPGLPLSIPQPSVPAVVPQSAPPEPHREETLTAT
|
|---|
| Antibody information |
|---|
| Antibody name |
N391/68
|
|---|
| Applications |
Immunohistochemistry, Western blot
|
|---|
| Cross-references |
NeuroMab: N391_68.pdf
|
|---|
| Publications |
PMID: 30667360
|
|---|
| Deposited by |
From UC Davis/NIH NeuroMab Facility
|
|---|
| Would you like to obtain this antibody? |
|---|
It can be produced at the Geneva Antibody facility (for more information, please check here).
|
