Expasy logo

ABCD

ABCD_AV347 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9JIH7 Rattus norvegicus (Rat)
Target name Wnk1, Hsn2, Prkwnk1, Serine/threonine-protein kinase WNK1, Protein kinase lysine-deficient 1, Protein kinase with no lysine 1
Epitope Sequence:
MSDGTAEKQSGTPGFLSPPAPVPKNGSSSDSSVGEKLGAAVADSGIGRTEEYRRRRHTMD
KDSRGAAATTTPTEHRFFRRSVICDSNATALELPGLPLSIPQPSVPAVVPQSAPPEPHRE
ETLTAT
Antibody information
Antibody name N391/68
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N391_68.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.