ABCD_AV353 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P23576 Rattus norvegicus (Rat) UniProt: P26048 Mus musculus (Mouse) |
| Target name | Gabra2, Gabra-2, Gamma-aminobutyric acid receptor subunit alpha-2, GABA(A) receptor subunit alpha-2 |
| Epitope | Sequence:VNDKKKEKGSVMIQNNAYAVAVANYAPNLSKDPVLS |
| Antibody information | |
| Antibody name | N399/19R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N399_19.pdf Addgene: 177544 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |