Expasy logo

ABCD

ABCD_AV353 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P23576 Rattus norvegicus (Rat)
UniProt: P26048 Mus musculus (Mouse)
Target name Gabra2, Gabra-2, Gamma-aminobutyric acid receptor subunit alpha-2, GABA(A) receptor subunit alpha-2
Epitope Sequence:
VNDKKKEKGSVMIQNNAYAVAVANYAPNLSKDPVLS
Antibody information
Antibody name N399/19R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N399_19.pdf
Addgene: 177544
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).