ABCD_AV362 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P51796 Rattus norvegicus (Rat) UniProt: Q9WVD4 Mus musculus (Mouse) UniProt: P51795 Homo sapiens (Human) |
| Target name | Clcn5, H(+)/Cl(-) exchange transporter 5, Chloride channel protein 5, ClC-5, Chloride transporter ClC-5 |
| Epitope | Sequence:TPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPMPPYTPPT |
| Antibody information | |
| Antibody name | N406/47.5 |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: N406_47.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |