Expasy logo

ABCD

ABCD_AV363 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P51796 Rattus norvegicus (Rat)
UniProt: Q9WVD4 Mus musculus (Mouse)
UniProt: P51795 Homo sapiens (Human)
Target name Clcn5, H(+)/Cl(-) exchange transporter 5, Chloride channel protein 5, ClC-5, Chloride transporter ClC-5
Epitope Sequence:
TPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGI
YDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTY
SGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPMPPYTPPT
Antibody information
Antibody name N406/47.6
Applications Immunohistochemistry
Cross-references NeuroMab: N406_47.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).