ABCD_AV364 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: Q8CJH6 Rattus norvegicus (Rat) UniProt: Q8BGD7 Mus musculus (Mouse) |
Target name | Npas4, Nxf, Neuronal PAS domain-containing protein 4, Neuronal PAS4, HLH-PAS transcription factor NXF |
Epitope | Sequence:PLSVDVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLEPLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTPDPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGVSTFPYEGFADELHQLQSQVQDSFHEDGSGGEPTF |
Antibody information | |
Antibody name | N408/62 |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: N408_62.pdf |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|