ABCD_AV365 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q8CJH6 Rattus norvegicus (Rat) UniProt: Q8BGD7 Mus musculus (Mouse) |
| Target name | Npas4, Nxf, Neuronal PAS domain-containing protein 4, Neuronal PAS4, HLH-PAS transcription factor NXF |
| Epitope | Sequence:PLSVDVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLEPLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTPDPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGVSTFPYEGFADELHQLQSQVQDSFHEDGSGGEPTF |
| Antibody information | |
| Antibody name | N408/79_a |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N408_79.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |