ABCD_AV367 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: E9Q7U0 Mus musculus (Mouse) UniProt: A7VL23 Rattus norvegicus (Rat) UniProt: Q9NPA1 Homo sapiens (Human) |
| Target name | Kcnmb3, Calcium-activated potassium channel subunit beta-3, Calcium-activated potassium channel subfamily M subunit beta-3, Maxi K channel subunit beta-3 |
| Epitope | Sequence:MQPFSIPVQITLQGGRRRQGRTALPASGKINGDPLKVHPKLPSSAGEDR |
| Antibody information | |
| Antibody name | N40B/18 |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: N40B_18.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |