ABCD_AV389 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9D8C3 Mus musculus (Mouse) UniProt: Q9NP73 Homo sapiens (Human) UniProt: Q5I0K7 Rattus norvegicus (Rat) |
| Target name | Alg13, Glt28d1, Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13, Asparagine-linked glycosylation 13 homolog, Glycosyltransferase 28 domain-containing protein 1, UDP-N-acetylglucosamine transferase subunit ALG13 homolog |
| Epitope | Sequence:MKRAFVTVGTTSFDELVARVVANDCVQILESLGYNHLVLQVGRGTVVPKPFRTESFTLDVYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEGHLFYCTCRVLSCPAPVSLLLVLLGSAKILQQLPSATLSCFGYLPT |
| Antibody information | |
| Antibody name | N442/28 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N442_28.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |