Expasy logo

ABCD

ABCD_AV389 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9D8C3 Mus musculus (Mouse)
UniProt: Q9NP73 Homo sapiens (Human)
UniProt: Q5I0K7 Rattus norvegicus (Rat)
Target name Alg13, Glt28d1, Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13, Asparagine-linked glycosylation 13 homolog, Glycosyltransferase 28 domain-containing protein 1, UDP-N-acetylglucosamine transferase subunit ALG13 homolog
Epitope Sequence:
MKRAFVTVGTTSFDELVARVVANDCVQILESLGYNHLVLQVGRGTVVPKPFRTESFTLDV
YRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFELAKQLHKEG
HLFYCTCRVLSCPAPVSLLLVLLGSAKILQQLPSATLSCFGYLPT
Antibody information
Antibody name N442/28
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N442_28.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).