ABCD_AV391 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9BZC1 Homo sapiens (Human) UniParc: UPI0001B79B39 UniProt: Q7TSY6 Mus musculus (Mouse) |
| Target name | CELF4, BRUNOL4, CUGBP Elav-like family member 4, CELF-4, Bruno-like protein 4, CUG-BP- and ETR-3-like factor 4, RNA-binding protein BRUNOL-4 |
| Epitope | Sequence:YIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEKDLKPLFEEFGKIYELTVLK |
| Antibody information | |
| Antibody name | N446/80 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N446_80.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |