Expasy logo

ABCD

ABCD_AV391 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9BZC1 Homo sapiens (Human)
UniProt: F1M6I9
UniProt: Q7TSY6 Mus musculus (Mouse)
Target name CELF4, BRUNOL4, CUGBP Elav-like family member 4, CELF-4, Bruno-like protein 4, CUG-BP- and ETR-3-like factor 4, RNA-binding protein BRUNOL-4
Epitope Sequence:
YIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQI
PRNLDEKDLKPLFEEFGKIYELTVLK
Antibody information
Antibody name N446/80
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N446_80.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).