Expasy logo

ABCD

ABCD_AV392 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: O54852 Rattus norvegicus (Rat)
UniProt: Q9ER47 Mus musculus (Mouse)
UniProt: Q9NS40 Homo sapiens (Human)
Target name Kcnh7, Erg3, Potassium voltage-gated channel subfamily H member 7, Ether-a-go-go-related gene potassium channel 3, ERG-3, Eag-related protein 3, Ether-a-go-go-related protein 3, Voltage-gated potassium channel subunit Kv11.3
Epitope Sequence:
SEGDKDFSKENSANDADDSTDTIRRYQSSKKHFEEKKSRSSSFISSIDDEQKPLFLGTVD
STPRMVKASRHHGEEAAPPSGRIHTDKRSHSCKDITDTHSWEREHARAQPEECSPSGLQR
AAWGISETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQAILQLL
Antibody information
Antibody name N447/24.7
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N447_24.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).