ABCD_AV402 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P48543 Mus musculus (Mouse) UniProt: Q63511 Rattus norvegicus (Rat) UniProt: Q92806 Homo sapiens (Human) |
| Target name | Kcnj9, Girk3, G protein-activated inward rectifier potassium channel 3, GIRK-3, Inward rectifier K(+) channel Kir3.3, Potassium channel, inwardly rectifying subfamily J member 9 |
| Epitope | Sequence:MAQENAAFSPGSEEPPRRRGR+AAARLDAHLYWSIPSRLDEKVEEEGAGEGAGAGDGADKEHNGCLPPPESESKV |
| Antibody information | |
| Antibody name | N455/15 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N455_15.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |