ABCD_AV403 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: Q5PRE5 Mus musculus (Mouse) UniProt: Q86XN7 Homo sapiens (Human) UniProt: D4A1X9 Rattus norvegicus (Rat) |
Target name | Proser1, Proline and serine-rich protein 1 |
Epitope | Sequence:DKKSFETVLDEIRKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVHPAEVVSILSCFTFSKDKLAALELLASNIVDAQNSRPIEDLFRINMSEKKRCKRVLEQASKAGCKAPHAMISSCGTFPGNPYPKGKPSRINGIFPGTPLKKDGEEITNEGKGIAARILGPSKPPPSTYNPHKPVPYP |
Antibody information | |
Antibody name | N456/39 |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: N456_39.pdf |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|