ABCD_AV405 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P97837 Rattus norvegicus (Rat) UniProt: Q8BJ42 Mus musculus (Mouse) UniProt: Q9P1A6 Homo sapiens (Human) |
| Target name | Dlgap2, Dap2, Disks large-associated protein 2, DAP-2, PSD-95/SAP90-binding protein 2, SAP90/PSD-95-associated protein 2, SAPAP2 |
| Epitope | Sequence:PAPRNMKGLTGSRNQPQLCVGHTCGLSPTDECEHPHDHVRHGPDVRQPYLLSPAESCPMDHHRCSPRSSVHSECMMMPVMLGDHVSSSTFPRMHYSSHYDTRDDCATSHASTKVNRIPANLLDQFEKQLPLHRDGFHTLQYHRASAATEQRNESPGRIRHLVHSVQKLFT |
| Antibody information | |
| Antibody name | N459/84 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N459_84.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |