ABCD_AV409 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: O75140 Homo sapiens (Human) UniProt: P61460 Mus musculus (Mouse) UniProt: A0A0G2K6M8 Rattus norvegicus (Rat) |
Target name | DEPDC5, GATOR complex protein DEPDC5, DEP domain-containing protein 5 |
Epitope | Sequence:TKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPNDEYSPLLLQVKSLKEDLQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFY |
Antibody information | |
Antibody name | N463/52 |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: N463_52.pdf |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|