ABCD_AV409 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O75140 Homo sapiens (Human) UniProt: P61460 Mus musculus (Mouse) UniProt: A0A0G2K6M8 Rattus norvegicus (Rat) |
| Target name | DEPDC5, GATOR complex protein DEPDC5, DEP domain-containing protein 5 |
| Epitope | Sequence:TKVYKLVIHKKGFGGSDDELVVNPKVFPHIKLGDIVEIAHPNDEYSPLLLQVKSLKEDLQKETISVDQTVTQVFRLRPYQDVYVNVVDPKDVTLDLVELTFKDQYIGRGDMWRLKKSLVSTCAYITQKVEFAGIRAQAGELWVKNEKVMCGYISEDTRVVFRSTSAMVYIFIQMSCEMWDFDIYGDLYFEKAVNGFLADLFTKWKEKNCSHEVTVVLFSRTFY |
| Antibody information | |
| Antibody name | N463/52 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N463_52.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |