ABCD_AV410 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q8JZN3 Mus musculus (Mouse) UniProt: O70596 Rattus norvegicus (Rat) |
| Target name | Kcnj14, Irk4, ATP-sensitive inward rectifier potassium channel 14, Inward rectifier K(+) channel Kir2.4, IRK-4, Potassium channel, inwardly rectifying subfamily J member 14 |
| Epitope | Sequence:SAKELDERAEQASHSPKSSFPGSLTAFCYENELALSCCQEEDEEEDTKEGTSAETPERAASPQALTPTLALTLPP |
| Antibody information | |
| Antibody name | N465/11 |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: N465_11.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |