ABCD_AV411 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: G5E845 Mus musculus (Mouse) UniProt: D3ZLR9 Rattus norvegicus (Rat) |
| Target name | KCNK16, TALK1, Potassium channel subfamily K member 16, 2P domain potassium channel Talk-1, TWIK-related alkaline pH-activated K(+) channel 1, TALK-1 |
| Epitope | Sequence:QSRDQFQLEKLRFLENYTCLDQQALEQFVQVILEAWVKGVNPKGNSTNPSNWD+RCSRLWQLIRGLDLKDGAAPDSEPRSQKIPISA |
| Antibody information | |
| Antibody name | N466/14 |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: N466_14.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |