Expasy logo

ABCD

ABCD_AV413 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q76M80 Mus musculus (Mouse)
UniProt: Q9ERS1 Rattus norvegicus (Rat)
Target name KCNK12, Potassium channel subfamily K member 12, Tandem pore domain halothane-inhibited potassium channel 2, THIK-2
Epitope Sequence:
LSCRCCTRCCPAPGAPLARRNAITPGSRLRRRLAALGADPATRDSDAEGRRLSGELISMR
DLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNG
Antibody information
Antibody name N468/37
Applications Immunohistochemistry
Cross-references NeuroMab: N468_37.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).