ABCD_AV413 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q76M80 Mus musculus (Mouse) UniProt: Q9ERS1 Rattus norvegicus (Rat) |
| Target name | KCNK12, Potassium channel subfamily K member 12, Tandem pore domain halothane-inhibited potassium channel 2, THIK-2 |
| Epitope | Sequence:LSCRCCTRCCPAPGAPLARRNAITPGSRLRRRLAALGADPATRDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNG |
| Antibody information | |
| Antibody name | N468/37 |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: N468_37.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |