Expasy logo

ABCD

ABCD_AV424 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9D394 Mus musculus (Mouse)
UniProt: Q5FVJ0 Rattus norvegicus (Rat)
UniProt: Q7L099 Homo sapiens (Human)
Target name Rufy3, Ripx, Protein RUFY3, Rap2-interacting protein x, RIPx, Single axon-regulated protein 1, Singar1
Epitope Sequence:
RQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRL
EEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH
Antibody information
Antibody name N483/26R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N483_26.pdf
Addgene: 177557
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.