ABCD_AV425 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9D394 Mus musculus (Mouse) UniProt: Q5FVJ0 Rattus norvegicus (Rat) UniProt: Q7L099 Homo sapiens (Human) |
| Target name | Rufy3, Ripx, Protein RUFY3, Rap2-interacting protein x, RIPx, Single axon-regulated protein 1, Singar1 |
| Epitope | Sequence:RQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH |
| Antibody information | |
| Antibody name | N483/84R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N483_84.pdf Addgene: 177558 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |