ABCD_AV428 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9CZM9 Mus musculus (Mouse) UniProt: Q9Y691 Homo sapiens (Human) UniProt: Q811Q0 Rattus norvegicus (Rat) |
| Target name | Kcnmb2, Calcium-activated potassium channel subunit beta-2, BK channel subunit beta-2, BKbeta2, Calcium-activated potassium channel, subfamily M subunit beta-2, Charybdotoxin receptor subunit beta-2, K(VCA)beta-2, Maxi K channel subunit beta-2, Slo-beta-2 |
| Epitope | Sequence:MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALK |
| Antibody information | |
| Antibody name | N53/32R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N53_32.pdf Addgene: 177561 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |