ABCD_AV440 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: O75899 Homo sapiens (Human) UniProt: Q80T41 Mus musculus (Mouse) UniProt: O88871 Rattus norvegicus (Rat) |
Target name | GABBR2, GPR51, GPRC3B, Gamma-aminobutyric acid type B receptor subunit 2, GABA-B receptor 2, GABA-B-R2, GABA-BR2, GABABR2, Gb2, G-protein coupled receptor 51, HG20 |
Epitope | Sequence:PQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGVDAS |
Antibody information | |
Antibody name | N81/2 |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: N81_2.pdf |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|