ABCD_AV445 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P63080 Mus musculus (Mouse) UniProt: P63079 Rattus norvegicus (Rat) UniProt: P28472 Homo sapiens (Human) |
| Target name | Gabrb3, Gabrb-3, Gamma-aminobutyric acid receptor subunit beta-3, GABA(A) receptor subunit beta-3 |
| Epitope | Sequence:APMDVHNEMNEVAGSVGDTRNSAISFDNSGIQYRKQSMPKEGHGRYMGDRSIPHKKTHLRRRSS |
| Antibody information | |
| Antibody name | N87/25R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N87_25.pdf Addgene: 177573 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |