ABCD_AV446 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P63080 Mus musculus (Mouse) UniProt: P63079 Rattus norvegicus (Rat) UniProt: P28472 Homo sapiens (Human) |
| Target name | Gabrb3, Gabrb-3, Gamma-aminobutyric acid receptor subunit beta-3, GABA(A) receptor subunit beta-3 |
| Epitope | Sequence:APMDVHNEMNEVAGSVGDTRNSAISFDNSGIQYRKQSMPKEGHGRYMGDRSIPHKKTHLRRRSS |
| Antibody information | |
| Antibody name | N87/25.5 |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N87_25.pdf |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |