Expasy logo

ABCD

ABCD_AV446 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P63080 Mus musculus (Mouse)
UniProt: P63079 Rattus norvegicus (Rat)
UniProt: P28472 Homo sapiens (Human)
Target name Gabrb3, Gabrb-3, Gamma-aminobutyric acid receptor subunit beta-3, GABA(A) receptor subunit beta-3
Epitope Sequence:
APMDVHNEMNEVAGSVGDTRNSAISFDNSGIQYRKQSMPKEGHGRYMGDRSIPHKKTHLR
RRSS
Antibody information
Antibody name N87/25.5
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N87_25.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).