ABCD_AV456 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q00960 Rattus norvegicus (Rat) UniProt: Q00960 Rattus norvegicus (Rat) UniProt: Q01097 Mus musculus (Mouse) |
| Target name | Grin2b, Glutamate receptor ionotropic, NMDA 2B, GluN2B, Glutamate [NMDA] receptor subunit epsilon-2, N-methyl D-aspartate receptor subtype 2B, NMDAR2B, NR2B |
| Epitope | Sequence:AVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVPS |
| Antibody information | |
| Antibody name | N59/36.1R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: N59_36.pdf Addgene: 114508 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |