ABCD_AV457 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: Q63563 Rattus norvegicus (Rat) UniProt: O60706 Homo sapiens (Human) UniProt: P70170 Mus musculus (Mouse) |
Target name | Abcc9, Sur2, ATP-binding cassette sub-family C member 9, Sulfonylurea receptor 2 |
Epitope | Sequence:[protein fragment, 43 aa] |
Antibody information | |
Antibody name | N323B/20.1 |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: N323B_20.pdf |
Publications | PMID: 30667360 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|