Expasy logo

ABCD

ABCD_AV457 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q63563 Rattus norvegicus (Rat)
UniProt: O60706 Homo sapiens (Human)
UniProt: P70170 Mus musculus (Mouse)
Target name Abcc9, Sur2, ATP-binding cassette sub-family C member 9, Sulfonylurea receptor 2
Epitope Sequence:
[protein fragment, 43 aa]
Antibody information
Antibody name N323B/20.1
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N323B_20.pdf
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).