Expasy logo

ABCD

ABCD_AW138 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P12661 Bos taurus (Bovine)
Target name RBP3, Retinol-binding protein 3, Interphotoreceptor retinoid-binding protein, IRBP, Interstitial retinol-binding protein, Protein 7S
Epitope Sequence:
VRPKEASSGPEEEAEEPPEAVPEVPEDEAVRRALVDSVFQVSVLPGNVGYLRFDSFADAS
V
Antibody information
Antibody name anti-IRBP mAb5
Antibody synonyms anti-IRBP #5, Hybridoma F3F5 derived
Comments Caution: The sequence appearing on the corresponding PDB entry is identical to ABCD_AH376, but it does not correspond to the sequence described on the supplemental material (Fig. S5).
Applications ELISA, Surface plasmon resonance, Western blot, X-ray crystallography
Cross-references PDB: 7JTI
Cellosaurus: CVCL_E4RC
Publications PMID: 32860273
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.