| Antigen information |
|---|
| Target type |
Protein
|
|---|
| Target link |
UniProt: P12661 Bos taurus (Bovine)
|
|---|
| Target name |
RBP3, Retinol-binding protein 3, Interphotoreceptor retinoid-binding protein, IRBP, Interstitial retinol-binding protein, Protein 7S
|
|---|
| Epitope |
Sequence:VRPKEASSGPEEEAEEPPEAVPEVPEDEAVRRALVDSVFQVSVLPGNVGYLRFDSFADASV
|
|---|
| Antibody information |
|---|
| Antibody name |
anti-IRBP mAb5
|
|---|
| Antibody synonyms |
anti-IRBP #5, Hybridoma F3F5 derived
|
|---|
| Comments |
Caution: The sequence appearing on the corresponding PDB entry is identical to ABCD_AH376, but it does not correspond to the sequence described on the supplemental material (Fig. S5).
|
|---|
| Applications |
ELISA, Surface plasmon resonance, Western blot, X-ray crystallography
|
|---|
| Cross-references |
PDB: 7JTI
|
|---|
| Publications |
PMID: 32860273
|
|---|
| Would you like to obtain this antibody? |
|---|
It can be produced at the Geneva Antibody facility (for more information, please check here).
|
