ABCD_AW138 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P12661 Bos taurus (Bovine) |
| Target name | RBP3, Retinol-binding protein 3, Interphotoreceptor retinoid-binding protein, IRBP, Interstitial retinol-binding protein, Protein 7S |
| Epitope | Sequence:VRPKEASSGPEEEAEEPPEAVPEVPEDEAVRRALVDSVFQVSVLPGNVGYLRFDSFADASV |
| Antibody information | |
| Antibody name | anti-IRBP mAb5 |
| Antibody synonyms | anti-IRBP #5, Hybridoma F3F5 derived |
| Comments | Caution: The sequence appearing on the corresponding PDB entry is identical to ABCD_AH376, but it does not correspond to the sequence described on the supplemental material (Fig. S5). |
| Applications | ELISA, Surface plasmon resonance, Western blot, X-ray crystallography |
| Cross-references | PDB: 7JTI Cellosaurus: CVCL_E4RC |
| Publications | PMID: 32860273 |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |