Expasy logo

ABCD

ABCD_AW896 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q71RJ2 Rattus norvegicus (Rat)
UniProt: O88602 Mus musculus (Mouse)
Target name Cacng2, Stg, Voltage-dependent calcium channel gamma-2 subunit, Neuronal voltage-gated calcium channel gamma-2 subunit, Stargazin, Transmembrane AMPAR regulatory protein gamma-2, TARP gamma-2
Epitope Sequence:
DRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNT
LPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTP
V
Antibody information
Antibody name N245/1R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N245_1.pdf
Addgene: 177521
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).