ABCD_AW896 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q71RJ2 Rattus norvegicus (Rat) UniProt: O88602 Mus musculus (Mouse) |
| Target name | Cacng2, Stg, Voltage-dependent calcium channel gamma-2 subunit, Neuronal voltage-gated calcium channel gamma-2 subunit, Stargazin, Transmembrane AMPAR regulatory protein gamma-2, TARP gamma-2 |
| Epitope | Sequence:DRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVHNCIQKDSKDSLHANTANRRTTPV |
| Antibody information | |
| Antibody name | N245/1R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N245_1.pdf Addgene: 177521 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |