ABCD_AW897 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9R0N7 Mus musculus (Mouse) UniProt: Q62747 Rattus norvegicus (Rat) |
| Target name | Syt7, SytVII, Synaptotagmin-7, Synaptotagmin VII |
| Epitope | Sequence:STLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVS |
| Antibody information | |
| Antibody name | N275/14R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N275_14.pdf Addgene: 177526 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |