ABCD_AW899 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9WV48 Rattus norvegicus (Rat) UniProt: D3YZU1 Mus musculus (Mouse) UniProt: Q9Y566 Homo sapiens (Human) |
| Target name | Shank1, SH3 and multiple ankyrin repeat domains protein 1, GKAP/SAPAP-interacting protein, SPANK-1, Somatostatin receptor-interacting protein, SSTR-interacting protein, SSTRIP |
| Epitope | Sequence:QGQSQPSAPSTKLSSGTLRSASSPRGARARSPSRGRHPEDAKRQPRGRPSSSGTPRDGPAGGTGGSGGPGGSLGSRGRRRKLYSAVPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVANRSQEGRQESRSDKAKRLFRHYTVGSYDSFDAPSLIDGIDSGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFT |
| Antibody information | |
| Antibody name | N22/21R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N22_21.pdf Addgene: 177516 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |