ABCD_AW902 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q62936 Rattus norvegicus (Rat) UniProt: P70175 Mus musculus (Mouse) UniProt: Q92796 Homo sapiens (Human) |
| Target name | DLG3, Disks large homolog 3, Neuroendocrine-DLG, Synapse-associated protein 102, SAP-102, SAP102, XLMR |
| Epitope | Sequence:MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKNTPKLNGSGPSWWPECTCTNRDWYEQA |
| Antibody information | |
| Antibody name | N19/2R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: N19_2.pdf Addgene: 177510 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |