ABCD_AW903 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P61168 Mus musculus (Mouse) UniProt: P61169 Rattus norvegicus (Rat) |
| Target name | Drd2, D(2) dopamine receptor, Dopamine D2 receptor |
| Epitope | Sequence:KIYIVLRKRRKRVNTKRSSRAFRANLKTPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQ |
| Antibody information | |
| Antibody name | N186/29R |
| Applications | Immunohistochemistry |
| Cross-references | NeuroMab: N186_29.pdf Addgene: 177509 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |