Expasy logo

ABCD

ABCD_AW905 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link InterPro: IPR031904
Target name Cadherin, C-terminal catenin-binding domain
Epitope Sequence:
APPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGG
AGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKK
EKK
This antibody cross-reacts with all mouse Gamma-protocadherin-A, -B and -C proteins.
Antibody information
Antibody name N159/5R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N159_5.pdf
Addgene: 177503
Deposited by From UC Davis/NIH NeuroMab Facility
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).