Expasy logo

ABCD

ABCD_AW906 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9BW11 Homo sapiens (Human)
Target name MXD3, BHLHC13, MAD3, Max dimerization protein 3, Max dimerizer 3, Class C basic helix-loop-helix protein 13, bHLHc13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx
Epitope Sequence:
ARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDV
ESLVFGGEAELLRGFVAGQEHSYSHGGGAWL
Antibody information
Antibody name N129/15R
Applications Immunohistochemistry, Western blot
Cross-references NeuroMab: N129_15.pdf
Addgene: 177498
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.