ABCD_AW906 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9BW11 Homo sapiens (Human) |
| Target name | MXD3, BHLHC13, MAD3, Max dimerization protein 3, Max dimerizer 3, Class C basic helix-loop-helix protein 13, bHLHc13, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, Myx |
| Epitope | Sequence:ARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL |
| Antibody information | |
| Antibody name | N129/15R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N129_15.pdf Addgene: 177498 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |