ABCD_AW919 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: O14936 Homo sapiens (Human) UniProt: O70589 Mus musculus (Mouse) UniProt: Q62915 Rattus norvegicus (Rat) UniProt: Q910A4 Danio rerio (Zebrafish) (Brachydanio rerio) UniProt: Q6DCN2 Xenopus laevis (African clawed frog) |
| Target name | CASK, LIN2, Peripheral plasma membrane protein CASK , hCASK, Calcium/calmodulin-dependent serine protein kinase, Protein lin-2 homolog |
| Epitope | Sequence:NSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEE |
| Antibody information | |
| Antibody name | K56A/50R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: K56A_50.pdf Addgene: 177443 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |