ABCD_AX004 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q923J1 Mus musculus (Mouse) UniProt: Q925B3 Rattus norvegicus (Rat) |
| Target name | Trpm7, Chak, Ltrpc7, Transient receptor potential cation channel subfamily M member 7, Channel-kinase 1, Long transient receptor potential channel 7, LTrpC-7, LTrpC7, Transient receptor potential-phospholipase C-interacting kinase, TRP-PLIK |
| Epitope | Sequence:LKLPDLKRNDYTPDKIIFPQDESSDLNLQSGNSTKESEATNSVRLML |
| Antibody information | |
| Antibody name | N74/25R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N74_25.pdf Addgene: 177569 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |