ABCD_AX010 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: P27732 Rattus norvegicus (Rat) UniProt: Q99246 Mus musculus (Mouse) UniProt: Q01668 Homo sapiens (Human) |
Target name | Cacna1d, Cach3, Cacn4, Cacnl1a2, Cchl1a2, Voltage-dependent L-type calcium channel subunit alpha-1D, Calcium channel L type alpha-1 polypeptide, Rat brain class D, RBD, Voltage-gated calcium channel subunit alpha Cav1.3 |
Epitope | Sequence: TPPATPPYRDWTPCYTPLIQVDRSESMDQVNGSLPSL |
Antibody information | |
Antibody name | N38/8R |
Applications | Immunohistochemistry, Western blot |
Cross-references | NeuroMab: N38_8.pdf Addgene: 177540 |
Deposited by | From UC Davis/NIH NeuroMab Facility |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|