ABCD_AX010 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P27732 Rattus norvegicus (Rat) UniProt: Q99246 Mus musculus (Mouse) UniProt: Q01668 Homo sapiens (Human) |
| Target name | Cacna1d, Cach3, Cacn4, Cacnl1a2, Cchl1a2, Voltage-dependent L-type calcium channel subunit alpha-1D, Calcium channel L type alpha-1 polypeptide, Rat brain class D, RBD, Voltage-gated calcium channel subunit alpha Cav1.3 |
| Epitope | Sequence: TPPATPPYRDWTPCYTPLIQVDRSESMDQVNGSLPSL |
| Antibody information | |
| Antibody name | N38/8R |
| Applications | Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: N38_8.pdf Addgene: 177540 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |